Iright
BRAND / VENDOR: Proteintech

Proteintech, 29587-1-AP, NCOA3 Polyclonal antibody

CATALOG NUMBER: 29587-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NCOA3 (29587-1-AP) by Proteintech is a Polyclonal antibody targeting NCOA3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 29587-1-AP targets NCOA3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, HEK-293 cells, Hela cells, Jurkat cells, K-562 cells, MCF-7 cells, PC-3 cells Positive IHC detected in: human lung cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NCOA3, also named as AIB1, SRC3 and TRAM1, belongs to the SRC/p160 nuclear receptor coactivator family. NCOA3 is a nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. NOCA3 plays a central role in creating a multisubunit coactivator complex, which probably acts via remodeling of chromatin. Involved in the coactivation of different nuclear receptors, such as for steroids (GR and ER), retinoids (RARs and RXRs), thyroid hormone (TRs), vitamin D3 (VDR) and prostanoids (PPARs). NCOA3 also involved in the coactivation of the NF-kappa-B pathway via its interaction with the NFKB1 subunit. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30633 Product name: Recombinant human NCOA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 742-958 aa of BC119001 Sequence: LDRDDPSDALSKELQPQVEGVDNKMSQCTSSTIPSSSQEKDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSLGLKSSQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGSSMGGPNRNVTVTQTPSSGDWGLPNSKAGRMEPMNSNSMGRPGGDYNTSLPRPALGGSI Predict reactive species Full Name: nuclear receptor coactivator 3 Calculated Molecular Weight: 1424 aa, 155 kDa Observed Molecular Weight: 150-160 kDa GenBank Accession Number: BC119001 Gene Symbol: NCOA3 Gene ID (NCBI): 8202 RRID: AB_2918328 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6Q9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924