Proteintech, 29594-1-AP, NUMB Polyclonal antibody

Size: 20ul / 150ul The NUMB (29594-1-AP) by Proteintech is a Polyclonal antibody targeting NUMB in WB, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 29594-1-AP targets NUMB in WB, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NUMB plays a role in the process of neurogenesis. It is required throughout embryonic neurogenesis to maintain neural progenitor cells, also called radial glial cells (RGCs), by allowing their daughter cells to choose progenitor over neuronal cell fate. NUMB may also mediate local repair of brain ventricular wall damage. NUMB may play a role infurther understanding the NUMB function in development and cancer. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31553 Product name: Recombinant human NUMB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 510-651 aa of NM_001005743 Sequence: SYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL Predict reactive species Full Name: numb homolog (Drosophila) Calculated Molecular Weight: 71KD Observed Molecular Weight: 66-72 kDa GenBank Accession Number: NM_001005743 Gene Symbol: NUMB Gene ID (NCBI): 8650 RRID: AB_2923598 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49757 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.