Product Description
Size: 20ul / 150ul
The SRGAP3 (29624-1-AP) by Proteintech is a Polyclonal antibody targeting SRGAP3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples
29624-1-AP targets SRGAP3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue
Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:2000-1:12000
Immunohistochemistry (IHC): IHC : 1:500-1:2000
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Background Information
SRGAP3 (SLIT-ROBO Rho GTPase Activating Protein 3), also named MEGAP and WRP, is a member of the Slit-Robo sub-family of Rho GTPase-activating proteins (Rho GAPs), controls actin and microtubule dynamics through negative regulation of Rac(PMID: 23108406). Diseases associated with SRGAP3 include Pilomyxoid Astrocytoma and Avoidant Personality Disorder. SRGAP3 is highly expressed in fetal and adult brain, including the cortex and the hippocampus.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag31196 Product name: Recombinant human SRGAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 823-947 aa of NM_014850 Sequence: PLLDDKASSKNDLQSPTEHISDYGFGGVMGRVRLRSDGAAIPRRRSGGDTHSPPRGLGPSIDTPPRAAACPSSPHKIPLTRGRIESPEKRRMATFGSAGSINYPDKKALSEGHSMRSTCGSTRHS Predict reactive species
Full Name: SLIT-ROBO Rho GTPase activating protein 3
Calculated Molecular Weight: 124 kDa
Observed Molecular Weight: 125 kDa
GenBank Accession Number: NM_014850
Gene Symbol: SRGAP3
Gene ID (NCBI): 9901
RRID: AB_2918334
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O43295
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924