Iright
BRAND / VENDOR: Proteintech

Proteintech, 29624-1-AP, SRGAP3 Polyclonal antibody

CATALOG NUMBER: 29624-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SRGAP3 (29624-1-AP) by Proteintech is a Polyclonal antibody targeting SRGAP3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 29624-1-AP targets SRGAP3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SRGAP3 (SLIT-ROBO Rho GTPase Activating Protein 3), also named MEGAP and WRP, is a member of the Slit-Robo sub-family of Rho GTPase-activating proteins (Rho GAPs), controls actin and microtubule dynamics through negative regulation of Rac(PMID: 23108406). Diseases associated with SRGAP3 include Pilomyxoid Astrocytoma and Avoidant Personality Disorder. SRGAP3 is highly expressed in fetal and adult brain, including the cortex and the hippocampus. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31196 Product name: Recombinant human SRGAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 823-947 aa of NM_014850 Sequence: PLLDDKASSKNDLQSPTEHISDYGFGGVMGRVRLRSDGAAIPRRRSGGDTHSPPRGLGPSIDTPPRAAACPSSPHKIPLTRGRIESPEKRRMATFGSAGSINYPDKKALSEGHSMRSTCGSTRHS Predict reactive species Full Name: SLIT-ROBO Rho GTPase activating protein 3 Calculated Molecular Weight: 124 kDa Observed Molecular Weight: 125 kDa GenBank Accession Number: NM_014850 Gene Symbol: SRGAP3 Gene ID (NCBI): 9901 RRID: AB_2918334 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43295 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924