Iright
BRAND / VENDOR: Proteintech

Proteintech, 29662-1-AP, SYNPO Polyclonal antibody

CATALOG NUMBER: 29662-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SYNPO (29662-1-AP) by Proteintech is a Polyclonal antibody targeting SYNPO in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 29662-1-AP targets SYNPO in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Synaptopodin is a actin-associated protein expressed in mature dendritic spines and renal podocytes. Several isoforms of synaptopodin have been reported: the 100 kDa neural form and 110 kDa renal form. 44-45 kDa may represent the degradation product of synaptopodin. As a podocyte specific protein, synaptopodin expression level was decreased in kidney but increased in the urinary podocytes from patients with preeclampsia, indicating that synaptopodin is a useful marker for preeclampsia. (15841212, 10555072) Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31287 Product name: Recombinant human SYNPO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 336-510 aa of BC146665 Sequence: SPPSYSVLYPSSDPKSSHLKGQAVPASKTGILEESMARRGSRKSMFTFVEKPKVTPNPDLLDLVQTADEKRRQRDQGEVGVEEEPFALGAEASNFQQEPAPRDRASPAAAEEVVPEWASCLKSPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIESSSHTPELARCPS Predict reactive species Full Name: synaptopodin Calculated Molecular Weight: 929 aa, 99 kDa Observed Molecular Weight: 44 kDa, 74-100 kDa GenBank Accession Number: BC146665 Gene Symbol: SYNPO Gene ID (NCBI): 11346 RRID: AB_3086150 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N3V7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924