Proteintech, 29707-1-AP, GGPS1 Polyclonal antibody

Size: 20ul / 150ul The GGPS1 (29707-1-AP) by Proteintech is a Polyclonal antibody targeting GGPS1 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 29707-1-AP targets GGPS1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, HEK-293 cells, mouse brain tissue, mouse heart tissue Positive IHC detected in: mouse testis tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31476 Product name: Recombinant human GGPS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 168-300 aa of BC067768 Sequence: DYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE Predict reactive species Full Name: geranylgeranyl diphosphate synthase 1 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 33-35 kDa GenBank Accession Number: BC067768 Gene Symbol: GGPS1 Gene ID (NCBI): 9453 RRID: AB_2923600 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95749 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.