Proteintech, 29749-1-AP, FGF10 Polyclonal antibody

Size: 20ul / 150ul The FGF10 (29749-1-AP) by Proteintech is a Polyclonal antibody targeting FGF10 in WB, IF-P, ELISA applications with reactivity to Human, Mouse samples 29749-1-AP targets FGF10 in WB, IF-P, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, NIH/3T3 cells Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information FGF10 belongs to the FGF7 subfamily. FGF10 is a paracrine signaling growth factor of 215 amino acids with a typical signal sequence for secretion and plays an essential role during development and tissue homeostasis in adults (PMID: 30405705). FGF10 is mainly produced by neuron and microglia/macrophages (PMID: 28981091). The calculated molecular weight of FGF10 is 23 kDa. Sometimes higher molecular weight around 40 kDa can also be observed, which may be a modified variant of FGF10. Specification Tested Reactivity: Human, Mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31278 Product name: Recombinant human FGF10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-150 aa of BC105021 Sequence: QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDC Predict reactive species Full Name: fibroblast growth factor 10 Observed Molecular Weight: 40 kDa GenBank Accession Number: BC105021 Gene Symbol: FGF10 Gene ID (NCBI): 2255 RRID: AB_2918343 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15520 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.