Proteintech, 29751-1-AP, STUB1 Polyclonal antibody

Size: 20ul / 150ul The STUB1 (29751-1-AP) by Proteintech is a Polyclonal antibody targeting STUB1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29751-1-AP targets STUB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HEK-293 cells, NIH/3T3 cells, PC-12 cells, mouse kidney tissue, rat kidney tissue Positive IHC detected in: rat lung tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information STUB1, also named as CHIP, SDCCAG7, UBOX1 and NY-CO-7, is a E3 ubiquitin-protein ligase which targets misfolded chaperone substrates towards proteasomal degradation. STUB1/CHIP modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. It mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation. STUB1/CHIP mediates polyubiquitination of CYP3A4.(PMID:10330192) CHIP/STUB1 strongly reduced keratin aggregates through increased degradation of mutant K14. (PMID:20151404) STUB1/CHIP regulates NAD(P)H:quinone oxidoreductase 1 (NQO1) accumulation in aged brain, a process impaired in certain Alzheimer patients.(PMID:21220432 ) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31335 Product name: Recombinant human STUB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 73-303 aa of BC007545 Sequence: MQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY Predict reactive species Full Name: STIP1 homology and U-box containing protein 1 Observed Molecular Weight: 35 kDa GenBank Accession Number: BC007545 Gene Symbol: STUB1 Gene ID (NCBI): 10273 RRID: AB_2923603 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNE7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.