Iright
BRAND / VENDOR: Proteintech

Proteintech, 29755-1-AP, EPX Polyclonal antibody

CATALOG NUMBER: 29755-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EPX (29755-1-AP) by Proteintech is a Polyclonal antibody targeting EPX in WB, IHC, ELISA applications with reactivity to human, mouse, pig samples 29755-1-AP targets EPX in WB, IHC, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: pig bone marrow tissue Positive IHC detected in: human hepatocirrhosis tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30561 Product name: Recombinant human EPX protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 580-673 aa of NM_000502 Sequence: LSQPRNLAQLSRVLKNQDLARKFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTKRQRKALSRISLSR Predict reactive species Full Name: eosinophil peroxidase Calculated Molecular Weight: 81 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: NM_000502 Gene Symbol: EPX Gene ID (NCBI): 8288 RRID: AB_3086154 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11678 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924