Proteintech, 29756-1-AP, FMNL3 Polyclonal antibody

Size: 20ul / 150ul The FMNL3 (29756-1-AP) by Proteintech is a Polyclonal antibody targeting FMNL3 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 29756-1-AP targets FMNL3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: human colon cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HUVEC cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information FMNL3 plays a role in the regulation of cell morphology and cytoskeletal organization. It is required in the control of cell shape and migration. In quiescent endothelial cells, FMNL3 triggers rearrangement of the actin cytoskeleton, but does not alter microtubule alignement. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30543 Product name: Recombinant human FMNL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 403-510 aa of NM_175736 Sequence: EHVSHLTEKLLDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAP Predict reactive species Full Name: formin-like 3 Calculated Molecular Weight: 117 kDa Observed Molecular Weight: 117 kDa GenBank Accession Number: NM_175736 Gene Symbol: FMNL3 Gene ID (NCBI): 91010 RRID: AB_3086155 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IVF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.