Iright
BRAND / VENDOR: Proteintech

Proteintech, 29760-1-AP, BIRC6 Polyclonal antibody

CATALOG NUMBER: 29760-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BIRC6 (29760-1-AP) by Proteintech is a Polyclonal antibody targeting BIRC6 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 29760-1-AP targets BIRC6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: DU 145 cells, LNCaP cells, PC-3 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information BIRC6 (Baculoviral IAP Repeat Containing 6), also known as BRUCE or APOLLON, is a member of the Inhibitors of Apoptosis Protein (IAP) family with a single BIR domain at its N-terminal and an active ubiquitin-conjugating (UBC) enzyme domain at its C-terminal(PMID: 23409057). In addition to its IAP activity, BIRC6 has the distinctive property of activity as a chimeric E2/E3 ubiquitin ligase in mammals. With its UBC domain, BIRC6 promotes the degradation of Smac and inhibits the activity of caspase-9, which play key roles in the initiation of apoptosis(PMID: 25933218). BIRC6 is highly expressed in many cancer types, where elevated expression of BIRC6 is significantly correlated with poor clinical outcome(PMID: 34729249). Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30729 Product name: Recombinant human BIRC6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4710-4857 aa of NM_016252 Sequence: GYERSRGTPSGTQSSREYDGNIRQATVKWAMLEQIRNPSPCFKEVIHKHFYLKRVEIMAQCEEWIADIQQYSSDKRVGRTMSHHAAALKRHTAQLREELLKLPCPEGLDPDTDDAPEVCRATTGAEETLMHDQVKPSSSKELPSDFQL Predict reactive species Full Name: baculoviral IAP repeat-containing 6 Calculated Molecular Weight: 530 kDa Observed Molecular Weight: 530 kDa GenBank Accession Number: NM_016252 Gene Symbol: BIRC6 Gene ID (NCBI): 57448 RRID: AB_2923604 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NR09 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924