Proteintech, 29784-1-AP, MPZL1 Polyclonal antibody

Size: 20ul / 150ul The MPZL1 (29784-1-AP) by Proteintech is a Polyclonal antibody targeting MPZL1 in WB, ELISA applications with reactivity to human, mouse, rat samples 29784-1-AP targets MPZL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, human placenta tissue, mouse kidney tissue, mouse liver tissue, rat kidney tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Myelin protein zero-like 1 (MPZL1, also known as PZR) is a transmembrane glycoprotein that promotes the migration of hepatocellular carcinoma cells and is involved in extracellular matrix-induced signal transduction (PMID: 16702974; 8912526). Phosphorylated MPZL1 was linked to the regulation of cell adhesion and migration (PMID: 24296779; 18378677; 12410637). The expression levels of MPZL1 were also associated with malignant features of ovarian cancer (PMID: 31233194). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31532 Product name: Recombinant human MPZL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-162 aa of BC007881 Sequence: SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPV Predict reactive species Full Name: myelin protein zero-like 1 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC007881 Gene Symbol: MPZL1 Gene ID (NCBI): 9019 RRID: AB_3669695 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95297 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.