Proteintech, 29804-1-AP, PPP1R13B Polyclonal antibody

Size: 20ul / 150ul The PPP1R13B (29804-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R13B in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 29804-1-AP targets PPP1R13B in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells Positive IHC detected in: human lung cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PPP1R13B(Protein phosphatase 1 regulatory subunit 13B), also named ASPP1 and KIAA0771, is a member of the apoptosis-stimulating proteins of the p53 family (ASPPs)(PMID: 30908929). PPP1R13B contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. PPP1R13 promotes DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor. Specification Tested Reactivity: Human, Mouse Cited Reactivity: sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30788 Product name: Recombinant human PPP1R13B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 730-887 aa of BC136527 Sequence: FNTLAGGMEGTPFYQPSPSQDFMGTLADVDNGNTNANGNLEELPPAQPTAPLPAEPAPSSDANDNELPSPEPEELICPQTTHQTAEPAEDNNNNVATVPTTEQIPSPVAEAPSPGEEQVPPAPLPPASHPPATSTNKRTNLKKPNSERTGHGLRVRFN Predict reactive species Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 13B Calculated Molecular Weight: 1090 aa, 120 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC136527 Gene Symbol: PPP1R13B Gene ID (NCBI): 23368 RRID: AB_2923610 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96KQ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.