Proteintech, 29809-1-AP, CAPN5 Polyclonal antibody

Size: 20ul / 150ul The CAPN5 (29809-1-AP) by Proteintech is a Polyclonal antibody targeting CAPN5 in WB, ELISA applications with reactivity to Human, Mouse samples 29809-1-AP targets CAPN5 in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, A431 cells, mouse colon tissue, A549 cells, HEK-293 cells, HeLa cells, HepG2 cells, SH-SY5Y cells, SKOV-3 cells, Y79 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Calpain-5 is a protein that in humans is encoded by the CAPN5 gene. Calpains are calcium-dependent cysteine proteases involved in signal transduction in a variety of cellular processes. A functional calpain protein consists of an invariant small subunit and 1 of a family of large subunits. CAPN5 is one of the large subunits. Unlike some of the calpains, CAPN5 and CAPN6 lack a calmodulin-like domain IV. Because of the significant similarity to Caenorhabditis elegans sex determination gene tra-3, CAPN5 is also called HTRA3. Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30479 Product name: Recombinant human CAPN5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-105 aa of BC018123 Sequence: MFSCVKPYEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPGPAVRWKRPKGICEDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWK Predict reactive species Full Name: calpain 5 Calculated Molecular Weight: 640 aa, 73 kDa Observed Molecular Weight: 65-73 kDa GenBank Accession Number: BC018123 Gene Symbol: CAPN5 Gene ID (NCBI): 726 RRID: AB_3086169 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15484 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.