Proteintech, 29811-1-AP, MIGA2/FAM73B Polyclonal antibody

Size: 20ul / 150ul The MIGA2/FAM73B (29811-1-AP) by Proteintech is a Polyclonal antibody targeting MIGA2/FAM73B in WB, ELISA applications with reactivity to human samples 29811-1-AP targets MIGA2/FAM73B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, U2O2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information MIGA2 (mitoguardin-2) also named as FAM73B, is a mitochondrial protein at contacts with the ER and/or lipid droplets (LDs), and identified as a lipid transporter. MIGA2 localizes to contact sites between mitochondria and the ER or mitochondria and lipid droplets (LDs) (PMID: 36282247). Based on its presence in many tissues, MIGA2 is likely critical for lipid and energy homeostasis in a wide spectrum of cell types (PMID: 31628041). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30577 Product name: Recombinant human FAM73B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 62-180 aa of BC009114 Sequence: AHQLKRRRRRKKQVGPEMGGEQLGTVPLPILLARKVPSVKKGYSSRRVQSPSSKSNDTLSGISSIEPSKHSGSSHSVASMMAVNSSSPTAACSGLWDARGMEESLTTSDGNAESLYMQG Predict reactive species Full Name: family with sequence similarity 73, member B Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC009114 Gene Symbol: MIGA2/FAM73B Gene ID (NCBI): 84895 RRID: AB_3086170 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L4E1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.