Iright
BRAND / VENDOR: Proteintech

Proteintech, 29818-1-AP, RAB3IP/Rabin8 Polyclonal antibody

CATALOG NUMBER: 29818-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RAB3IP/Rabin8 (29818-1-AP) by Proteintech is a Polyclonal antibody targeting RAB3IP/Rabin8 in WB, IP, ELISA applications with reactivity to human samples 29818-1-AP targets RAB3IP/Rabin8 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, A431 cells, HeLa cells, Jurkat cells Positive IP detected in: Jurkat cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information RAB3IP, also hnown as Rabin8, is a deduced 476-amino acid protein containing a central coiled-coil domain, a bipartite nuclear localization signal, and a C-terminal endoplasmic reticulum retention motif. Rabin8 has several sites for N-glycosylation and phosphorylation. Rabin8 plays important roles in various cellular processes, including ciliogenesis.The GEF activity of Rabin8 towards Rab8 is essential for ciliogenesis and cyst apical membrane transport,but not for exocytosis of discoidal/fusiform-shaped vesicles. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31291 Product name: Recombinant human RABIN8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-192 aa of BC015548 Sequence: LPGGKTPFKKGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSS Predict reactive species Full Name: RAB3A interacting protein (rabin3) Calculated Molecular Weight: 476 aa, 53 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC015548 Gene Symbol: RAB3IP Gene ID (NCBI): 117177 RRID: AB_3669697 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96QF0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924