Iright
BRAND / VENDOR: Proteintech

Proteintech, 29832-1-AP, MUC13 Polyclonal antibody

CATALOG NUMBER: 29832-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MUC13 (29832-1-AP) by Proteintech is a Polyclonal antibody targeting MUC13 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples 29832-1-AP targets MUC13 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HCT 116 cells, HEK-293 cells, HT-29 cells, SW480 cells, mouse kidney tissue, rat kidney tissue Positive IHC detected in: human colon cancer tissue, human colon tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Mucins (MUC) are highly glycosylated proteins that are abundantly expressed in mammalian epithelial cells. Mucin 13 (MUC13) is a member of the transmembrane glycoprotein mucins which is normally expressed in the large intestine, trachea, kidney, small intestine, and gastric epithelium (PMID: 22027689). MUC13 is involved in the tumorigenesis of multiple malignancies, including pancreatic cancer, colorectal cancer, renal cancer and lung cancer (PMID: 22027689; PMID: 31427737; PMID: 28205224; PMID: 34966453). Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31090 Product name: Recombinant human MUC13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 208-421 aa of NM_033049 Sequence: STCKKGKVFPGKISVTVSETFDPEEKHSMAYQDLHSEITSLFKDVFGTSVYGQTVILTVSTSLSPRSEMRADDKFVNVTIVTILAETTSDNEKTVTEKINKAIRSSSSNFLNYDLTLRCDYYGCNQTADDCLNGLACDCKSDLQRPNPQSPFCVASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDCKDKFQL Predict reactive species Full Name: mucin 13, cell surface associated Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 70-120 kDa GenBank Accession Number: NM_033049 Gene Symbol: MUC13 Gene ID (NCBI): 56667 RRID: AB_2923611 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3R2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924