Iright
BRAND / VENDOR: Proteintech

Proteintech, 29844-1-AP, VPS13C Polyclonal antibody

CATALOG NUMBER: 29844-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VPS13C (29844-1-AP) by Proteintech is a Polyclonal antibody targeting VPS13C in WB, ELISA applications with reactivity to human, mouse samples 29844-1-AP targets VPS13C in WB, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information VPS13C (vacuolar protein sorting 13 homolog C) acts at membrane contact sites between intracellular organelles to transport lipids. There are four VPS13 family members in human - VPS13A, VPS13B, VPS13C, and VPS13D. Mutations in human VPS13 genes are linked to rare neurodegenerative disorders: chorea- acanthocytosis (VPS13A), Cohen syndrome (VPS13B), predispose to early onset into Parkinson's disease (VPS13C) and lead to ataxia/spastic paraplegia (VPS13D) (PMID: 30656912). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31069 Product name: Recombinant human VPS13C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 95-253 aa of NM_017684 Sequence: SIKYDAVKEEKSLQDVKQKELSRIEEALQKAAEKGTHSGEFIYGLENFVYKDIKPGRKRKKHKKHFKKPFKGLDRSKDKPKEAKKDTFVEKLATQVIKNVQVKITDIHIKYEDDVTDPKRPLSFGVTLGELSLLTANEHWTPCILNEADKIIYKLIRLD Predict reactive species Full Name: vacuolar protein sorting 13 homolog C (S. cerevisiae) Calculated Molecular Weight: 422 kDa Observed Molecular Weight: 422 kDa GenBank Accession Number: NM_017684 Gene Symbol: VPS13C Gene ID (NCBI): 54832 RRID: AB_3086177 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q709C8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924