Product Description
Size: 20ul / 150ul
The BNIP3L (29848-1-AP) by Proteintech is a Polyclonal antibody targeting BNIP3L in WB, ELISA applications with reactivity to human samples
29848-1-AP targets BNIP3L in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Jurkat cells, K-562 cells, mouse brain cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Background Information
BNIP3L (also known as NIX) is a mitochondrial outer-membrane protein that belongs to the BH3-only subgroup of the BCL-2 family. Initially identified as a weak pro-apoptotic factor, it has emerged as a key mitophagy receptor that bridges damaged or surplus mitochondria to the autophagosome, thereby safeguarding mitochondrial quality and cellular homeostasis.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag31514 Product name: Recombinant human BNIP3L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 77-146 aa of BC001559 Sequence: DAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSS Predict reactive species
Full Name: BCL2/adenovirus E1B 19kDa interacting protein 3-like
Calculated Molecular Weight: 24 kDa
Observed Molecular Weight: 35-40 kDa
GenBank Accession Number: BC001559
Gene Symbol: BNIP3L
Gene ID (NCBI): 665
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O60238
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924