Proteintech, 29862-1-AP, ENT1 Polyclonal antibody

Size: 20ul / 150ul The ENT1 (29862-1-AP) by Proteintech is a Polyclonal antibody targeting ENT1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29862-1-AP targets ENT1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, HeLa cells, mouse heart tissue, rat liver tissue, mouse kidney tissue, mouse liver tissue Positive IHC detected in: human colon cancer tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ENT1 (equilibrative nucleoside transporter 1; also known as SLC29A1) is a ubiquitous protein located at the cell membrane and is a major transporter responsible for the cellular uptake and release of endogenous nucleosides such as adenosine, and nucleoside analogs used in chemotherapy. The predicted molecular weight of ENT1 is 50 kDa, while heavier 54-68 kDa band may be observed due to the glycosylation (PMID: 16448802, 11850433, 16111480). A smaller novel splice variant of the mouse ENT1 has also been identified, which generates a protein of 35-40 kDa (PMID: 18413666). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32003 Product name: Recombinant human ENT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-82 aa of NM_001372327.1 Sequence: NFFMTATQYFTNRLDMSQNVSLVTAELSKDAQASAAPAAPLPERNSLSAIFNN Predict reactive species Full Name: solute carrier family 29 (nucleoside transporters), member 1 Calculated Molecular Weight: 50KD Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_001372327.1 Gene Symbol: ENT1 Gene ID (NCBI): 2030 RRID: AB_2935484 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99808 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.