Proteintech, 29904-1-AP, TPH1 Polyclonal antibody

Size: 20ul / 150ul The TPH1 (29904-1-AP) by Proteintech is a Polyclonal antibody targeting TPH1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 29904-1-AP targets TPH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Tryptophan hydroxylase 1 (TPH1) is the rate-limiting enzyme in the synthesis of serotonin (5-HT) from the amino acid tryptophan. It is primarily found in peripheral tissues such as the gut, pineal gland, and spleen. TPH1 plays a crucial role in regulating peripheral serotonin levels, which are involved in various physiological processes including gastrointestinal motility and cardiovascular function. Additionally, TPH1 has been implicated in the regulation of blood glucose levels and is associated with conditions such as fatty liver disease. (PMID: 32590025, PMID: 36331742, PMID: 37652099) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31623 Product name: Recombinant human TPH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 385-444 aa of BC106739 Sequence: KMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI Predict reactive species Full Name: tryptophan hydroxylase 1 Calculated Molecular Weight: 466 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC106739 Gene Symbol: TPH1 Gene ID (NCBI): 7166 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17752 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.