Iright
BRAND / VENDOR: Proteintech

Proteintech, 29911-1-AP, Kindlin 2 Polyclonal antibody

CATALOG NUMBER: 29911-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Kindlin 2 (29911-1-AP) by Proteintech is a Polyclonal antibody targeting Kindlin 2 in WB, IHC, ELISA applications with reactivity to human samples 29911-1-AP targets Kindlin 2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells Positive IHC detected in: human lung cancer tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FERMT2, also named as KIND2, MIG2, PLEKHC1, MIG-2 and Kindlin-2, belongs to the kindlin family. There are three FERMT2 isoforms that participate in the connection between extracellular matrix (ECM) adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. FERMT2 recruits migfilin (FBLP1) protein to cell-ECM focal adhesion sites. Variable expression in human cancers and mesenchymal cancer invasion are now linked with FERMT2, which may plays important role in carcinormas development. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31795 Product name: Recombinant human Kindlin 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-441 aa of BC017327 Sequence: TSENHLNNSDKEVDEVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNI Predict reactive species Full Name: fermitin family homolog 2 (Drosophila) Calculated Molecular Weight: 680 aa, 78 kDa Observed Molecular Weight: 78 kDa GenBank Accession Number: BC017327 Gene Symbol: Kindlin 2 Gene ID (NCBI): 10979 RRID: AB_3086186 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96AC1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924