Proteintech, 29924-1-AP, MEGF9 Polyclonal antibody

Size: 20ul / 150ul The MEGF9 (29924-1-AP) by Proteintech is a Polyclonal antibody targeting MEGF9 in WB, ELISA applications with reactivity to Human samples 29924-1-AP targets MEGF9 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, Daudi cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31966 Product name: Recombinant human MEGF9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-420 aa of NM_001080497 Sequence: SSGKCQCKVGVIGSICDRCQDGYYGFSKNGCLPCQCNNRSASCDALTGACLNCQENSKGNHCEECKEGFYQSPDATKECLRCPCSAVTSTGSCSIKSSELEPECDQCKDGYIGPNCNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESG Predict reactive species Full Name: multiple EGF-like-domains 9 Calculated Molecular Weight: 63KD Observed Molecular Weight: 60-63 kDa GenBank Accession Number: NM_001080497 Gene Symbol: MEGF9 Gene ID (NCBI): 1955 RRID: AB_3086191 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H1U4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.