Iright
BRAND / VENDOR: Proteintech

Proteintech, 29924-1-AP, MEGF9 Polyclonal antibody

CATALOG NUMBER: 29924-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MEGF9 (29924-1-AP) by Proteintech is a Polyclonal antibody targeting MEGF9 in WB, ELISA applications with reactivity to Human samples 29924-1-AP targets MEGF9 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, Daudi cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31966 Product name: Recombinant human MEGF9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-420 aa of NM_001080497 Sequence: SSGKCQCKVGVIGSICDRCQDGYYGFSKNGCLPCQCNNRSASCDALTGACLNCQENSKGNHCEECKEGFYQSPDATKECLRCPCSAVTSTGSCSIKSSELEPECDQCKDGYIGPNCNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESG Predict reactive species Full Name: multiple EGF-like-domains 9 Calculated Molecular Weight: 63KD Observed Molecular Weight: 60-63 kDa GenBank Accession Number: NM_001080497 Gene Symbol: MEGF9 Gene ID (NCBI): 1955 RRID: AB_3086191 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H1U4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924