Iright
BRAND / VENDOR: Proteintech

Proteintech, 29949-1-AP, INPP5J Polyclonal antibody

CATALOG NUMBER: 29949-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The INPP5J (29949-1-AP) by Proteintech is a Polyclonal antibody targeting INPP5J in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 29949-1-AP targets INPP5J in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, MCF-7 cells, mouse heart tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information INPP5J(Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A) is also named as PIB5PA, PIPP and belongs to the inositol 1,4,5-trisphosphate 5-phosphatase type II family. INPP5J is a key signalling molecule that regulates dendritic outgrowth through activation of small GTPase signalling via interaction between FRMPD4 and ARHGEF7. It can control the resting membrane potential through a specific ion-channel-receptor-ligand interaction that brings about a large conformational change, analogous to neurotransmitter activation of ion channels at synapses. (PMID:22595022). This protein has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29242 Product name: Recombinant human INPP5J protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-150 aa of BC109288 Sequence: MALPRLGTQSTGPGRCLSPNLQAQEAPAPVTTSSSTSTLSSSPWSAQPTWKSDPGFRITVVTWNVGTAMPPDDVTSLLHLGGGDDSDGADMIAIGLQEVNSMLNKRLKDALFTDQWSELFMDALGPFNFVLVSSVRMQGVILLLFAKYYH Predict reactive species Full Name: inositol polyphosphate-5-phosphatase J Calculated Molecular Weight: 1006 aa, 107 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC109288 Gene Symbol: INPP5J Gene ID (NCBI): 27124 RRID: AB_2918353 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15735 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924