Proteintech, 29988-1-AP, KCNS1 Polyclonal antibody

Size: 20ul / 150ul The KCNS1 (29988-1-AP) by Proteintech is a Polyclonal antibody targeting KCNS1 in WB, ELISA applications with reactivity to Human, rat samples 29988-1-AP targets KCNS1 in WB, ELISA applications and shows reactivity with Human, rat samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, THP-1 cells, U-87 MG cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: Human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31380 Product name: Recombinant human KCNS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 430-526 aa of BC075033 Sequence: VTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHQEFEDLLSSVDGVSEASLETSRETSQEGQSADLESQAPSEPPHPQMY Predict reactive species Full Name: potassium voltage-gated channel, delayed-rectifier, subfamily S, member 1 Calculated Molecular Weight: 526 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC075033 Gene Symbol: KCNS1 Gene ID (NCBI): 3787 RRID: AB_3086205 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96KK3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.