Proteintech, 29989-1-AP, GPR37/Pael-R Polyclonal antibody

Size: 20ul / 150ul The GPR37/Pael-R (29989-1-AP) by Proteintech is a Polyclonal antibody targeting GPR37/Pael-R in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29989-1-AP targets GPR37/Pael-R in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The orphan G protein-coupled receptor GPR37, also known as PAELR (parkin-associated endothelin receptor-like receptor) or ETBR-LP-1 (endothelin B receptor-like protein 1), is a 613 aa, multi-pass membrane protein predominantly expressed in the brain. It is a substrate of parkin (PARK2). When overexpressed in cells, GPR37 tends to become insoluble, unfolded, and ubiquitinated in vivo. Accumulation of the unfolded protein may lead to dopaminergic neuronal death in juvenile Parkinson disease (JPD). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32431 Product name: Recombinant human GPR37 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-180 aa of BC040007 Sequence: SRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLF Predict reactive species Full Name: G protein-coupled receptor 37 (endothelin receptor type B-like) Calculated Molecular Weight: 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC040007 Gene Symbol: GPR37 Gene ID (NCBI): 2861 RRID: AB_2935493 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15354 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.