Proteintech, 30009-1-AP, PSME3 Polyclonal antibody

Size: 20ul / 150ul The PSME3 (30009-1-AP) by Proteintech is a Polyclonal antibody targeting PSME3 in WB, ELISA applications with reactivity to Human samples 30009-1-AP targets PSME3 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information PSME3 gene encodes proteasome activator complex subunit 3, which is also called REG-gamma or PA28-gamma. REG-gamma activates the trypsin-like catalytic subunit of the proteasome thus is a proteasome regulator. MDM2-TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of TP53, may be promoted by REG-gamma resulting in inhibited apoptosis after DNA damage. REG-gamma may also be involved in cell cycle regulation. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31969 Product name: Recombinant human PSME3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-138 aa of BC001423 Sequence: MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKM Predict reactive species Full Name: proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC001423 Gene Symbol: PSME3 Gene ID (NCBI): 10197 RRID: AB_2923628 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61289 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.