Proteintech, 30016-1-AP, TRA2A Polyclonal antibody

Size: 20ul / 150ul The TRA2A (30016-1-AP) by Proteintech is a Polyclonal antibody targeting TRA2A in WB, ELISA applications with reactivity to Human, mouse samples 30016-1-AP targets TRA2A in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: A549 cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information TRA2A is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30841 Product name: Recombinant human TRA2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-97 aa of BC017094 Sequence: SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRSRRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSR Predict reactive species Full Name: transformer 2 alpha homolog (Drosophila) Calculated Molecular Weight: 282 aa, 33 kDa Observed Molecular Weight: 33-35 kDa GenBank Accession Number: BC017094 Gene Symbol: TRA2A Gene ID (NCBI): 29896 RRID: AB_2923629 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13595 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.