Proteintech, 30021-1-AP, Glypican 3 Polyclonal antibody

Size: 20ul / 150ul The Glypican 3 (30021-1-AP) by Proteintech is a Polyclonal antibody targeting Glypican 3 in WB, IHC, ELISA applications with reactivity to human samples 30021-1-AP targets Glypican 3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HuH-7 cells Positive IHC detected in: human hepatocellular carcinomaNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Glypicans (GPCs) are a family of glycosylphosphatidylinositol (GPI)-anchored heparan sulfate proteoglycans (HSPGs) that may play a role in the control of cell division and growth regulation. In mammals, there are six GPCs (GPC1 to GPC6), all of which have a similar core-protein size of approx. 60 kDa and the clustering of glycosaminoglycan attachment site near the C-terminus. They are tethered to the cell surface by GPI linkages, which can be cleaved by endogenous phospholipases, thus releasing the protein. Glypican 3 (GPC3) is highly expressed in many tissues during development and plays an important role in the regulation of embryonic growth (PMID: 22467855). Loss-of-function mutations of GPC3 result in the Simpson-Golabi-Behmel overgrowth syndrome (SGBS), and Gpc-3 null mice display developmental overgrowth (PMID: 8589713; 18477453). In hepatocellular carcinoma (HCC), the overexpression of glypican 3 has been demonstrated to be a reliable diagnostic indicator (PMID: 19212669; 22706665). The calculated molecular weight of native glypican 3 is 66 kDa, and glycinate forms of glypican 3 have higher molecular weights than 66 kDa (PMID: 12851874; 16024626; 19574424). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32559 Product name: Recombinant human GPC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 415-554 aa of BC035972 Sequence: VAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHN Predict reactive species Full Name: glypican 3 Calculated Molecular Weight: 580 aa, 66 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC035972 Gene Symbol: GPC3 Gene ID (NCBI): 2719 RRID: AB_2935499 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51654 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.