Proteintech, 30022-1-AP, HIP14/ZDHHC17 Polyclonal antibody

Size: 20ul / 150ul The HIP14/ZDHHC17 (30022-1-AP) by Proteintech is a Polyclonal antibody targeting HIP14/ZDHHC17 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 30022-1-AP targets HIP14/ZDHHC17 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293T cells, Raji cells, U-251 cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ZDHHC17 is a neuronal palmitoyl transferase. Post-translational modification by the lipid palmitate is crucial for the correct targeting and function of many proteins. Polyglutamine expansions of huntingtin protein are responsible for the Huntington neurological disorder. ZDHHC17 gene encodes palmitoyl transferase huntingtin interacting protein (HIP14) which regulates palmitoylation and distribution of hungtingtin. The latter is implicated in the formation of inclusion bodies and enhanced neuronal toxicity. HIP14 was also shown to control neurotransmitter release. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32654 Product name: Recombinant human HIP14; ZDHHC17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-203 aa of BC050324 Sequence: MQREEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWDIVKATQYGIYERCRELVEAGYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHS Predict reactive species Full Name: zinc finger, DHHC-type containing 17 Calculated Molecular Weight: 73 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC050324 Gene Symbol: ZDHHC17 Gene ID (NCBI): 23390 RRID: AB_2935500 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IUH5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.