Proteintech, 30030-1-AP, AP2A1 Polyclonal antibody

Size: 20ul / 150ul The AP2A1 (30030-1-AP) by Proteintech is a Polyclonal antibody targeting AP2A1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 30030-1-AP targets AP2A1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, MCF-7 cells, SKOV-3 cells, SH-SY5Y cells, mouse kidney tissue, rat kidney tissue, mouse kidney cells, rat kidney cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:600-1:2400 Background Information AP2A1 encodes adaptor protein complex 2 (AP-2) subunit alpha-1, which is a 100 kDa coated vesicle protein. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 is involved in clathrin-dependent endocytosis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32232 Product name: Recombinant human AP2A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 616-724 aa of BC014214 Sequence: LKRKKGPGAGSALDDGRRDPSSNDINGGMEPTPSTVSTPSPSADLLGLRAAPPPAAPPASAGAGNLLVDVFDGPAAQPSLGPTPEEAFLSPGPEDIGPPIPEADELLNK Predict reactive species Full Name: adaptor-related protein complex 2, alpha 1 subunit Calculated Molecular Weight: 977 aa, 108 kDa Observed Molecular Weight: 108 kDa GenBank Accession Number: BC014214 Gene Symbol: AP2A1 Gene ID (NCBI): 160 RRID: AB_2935505 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95782 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.