Proteintech, 30042-1-AP, RACGAP1 Polyclonal antibody

Size: 20ul / 150ul The RACGAP1 (30042-1-AP) by Proteintech is a Polyclonal antibody targeting RACGAP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 30042-1-AP targets RACGAP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, K-562 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32468 Product name: Recombinant human RACGAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 540-632 aa of BC032754 Sequence: SQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK Predict reactive species Full Name: Rac GTPase activating protein 1 Calculated Molecular Weight: 632 aa, 71 kDa Observed Molecular Weight: 71 kDa GenBank Accession Number: BC032754 Gene Symbol: RACGAP1 Gene ID (NCBI): 29127 RRID: AB_3086216 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0H5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.