Proteintech, 30045-1-AP, Collagen Type XII Polyclonal antibody

Size: 20ul / 150ul The Collagen Type XII (30045-1-AP) by Proteintech is a Polyclonal antibody targeting Collagen Type XII in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 30045-1-AP targets Collagen Type XII in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: BxPC-3 cells, HeLa cells, SKOV-3 cells, C2C12 cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information COL12A1 (Collagen alpha-1(XII) chain), also known as COL12A1L. It is predicted to be located in the ECM. Type XII collagen interacts with type I collagen-containing fibrils, the COL1 domain could be associated with the surface of the fibrils, and the COL2 and NC3 domains may be localized in the perifibrillar matrix. The molecular weight of COL12A1 is 333 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32602 Product name: Recombinant human COL12A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 768-892 aa of NM_004370 Sequence: VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG Predict reactive species Full Name: collagen, type XII, alpha 1 Calculated Molecular Weight: 333kd Observed Molecular Weight: 310-333 kDa GenBank Accession Number: NM_004370 Gene Symbol: COL12A1 Gene ID (NCBI): 1303 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99715 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.