Proteintech, 30058-1-AP, ULBP3 Polyclonal antibody

Size: 20ul / 150ul The ULBP3 (30058-1-AP) by Proteintech is a Polyclonal antibody targeting ULBP3 in WB, ELISA applications with reactivity to Human samples 30058-1-AP targets ULBP3 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, MDA-MB-231 cells, SW480 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information ULBP3 (UL16 binding protein-3), a class 1 major histocompatibility complex-like (MHC-like) molecule and member of the family of ligands of the killer cell lectin-like receptor subfamily K member 1 (NKG2D) (PMID:31292299). ULBP3 are expressed at the cell surface of multiple types of cells and tissues as a glycosylphosphatidylinositol (GPI)-linked proteins (PMID:22741585). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32424 Product name: Recombinant human ULBP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-150 aa of Sequence: DAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFL Predict reactive species Full Name: UL16 binding protein 3 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28 kDa Gene Symbol: ULBP3 Gene ID (NCBI): 79465 RRID: AB_3086222 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BZM4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.