Product Description
Size: 20ul / 150ul
The PPP1CC (30070-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1CC in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
30070-1-AP targets PPP1CC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HEK-293 cells, HeLa cells, mouse brain tissue, rat brain tissue
Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:12000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
PPP1CC, also named as PP-1G, belongs to the PPP phosphatase family and PP-1 subfamily. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. It is involved in regulation of ionic conductances and long-term synaptic plasticity. PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag32348 Product name: Recombinant human PPP1CC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 206-323 aa of BC014073 Sequence: WSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK Predict reactive species
Full Name: protein phosphatase 1, catalytic subunit, gamma isoform
Calculated Molecular Weight: 35 kDa
Observed Molecular Weight: 35 kDa
GenBank Accession Number: BC014073
Gene Symbol: PPP1CC
Gene ID (NCBI): 5501
RRID: AB_3086223
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P36873
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924