Iright
BRAND / VENDOR: Proteintech

Proteintech, 30086-1-AP, PTRF Polyclonal antibody

CATALOG NUMBER: 30086-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PTRF (30086-1-AP) by Proteintech is a Polyclonal antibody targeting PTRF in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30086-1-AP targets PTRF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HT-1080 cells, NIH/3T3 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:800-1:3200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Polymerase I and transcript release factor(PTRF) is an essential factor in the biogenesis of caveolae, which involve in numerous process, such as signal transduction and membrane and lipid trafficking. PTRF can terminate transcription of RNA Pol I, which involves pausing of transcription by TTF1, and dissociation of the transcription complex, release the complex from the template. The calculated molecular weight of PTRF is 43 kDa, but modified PTRF is about 50-55 kDa. (PMID: 11139612 ) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32786 Product name: Recombinant human PTRF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC008849 Sequence: MEDAAALELSSDEAVEVEEVIEESRAERIKRSGLRRVDDFKKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFT Predict reactive species Full Name: polymerase I and transcript release factor Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC008849 Gene Symbol: PTRF Gene ID (NCBI): 284119 RRID: AB_2935513 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6NZI2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924