Iright
BRAND / VENDOR: Proteintech

Proteintech, 30104-1-AP, GPR151 Polyclonal antibody

CATALOG NUMBER: 30104-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GPR151 (30104-1-AP) by Proteintech is a Polyclonal antibody targeting GPR151 in WB, IHC, ELISA applications with reactivity to human samples 30104-1-AP targets GPR151 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells Positive IHC detected in: mouse brain tissue, human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information G protein-coupled receptors (GPCRs) are a superfamily of cell-surface receptors which are important for intracellular signal transduction. GPR151 (G protein-coupled receptor 151) is highly enriched in the the medial and lateral habenula and is expressed at presynaptic membranes and synaptic vesicles (PMID: 32098843). GPR151 has been reported to play an important role in modulating neuropathic pain and controling nicotine addiction vulnerability (PMID: 32098843,34244727,30373770). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32442 Product name: Recombinant human GPR151 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 308-419 aa of NM_194251 Sequence: VMSEEFREGLKGVWKWMITKKPPTVSESQETPAGNSEGLPDKVPSPESPASIPEKEKPSSPSSGKGKTEKAEIPILPDVEQFWHERDTVPSVQDNDPIPWEHEDQETGEGVK Predict reactive species Full Name: G protein-coupled receptor 151 Calculated Molecular Weight: 47kd Observed Molecular Weight: 46 kDa GenBank Accession Number: NM_194251 Gene Symbol: GPR151 Gene ID (NCBI): 134391 RRID: AB_3086229 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDV0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924