Product Description
Size: 20ul / 150ul
The C5orf51 (30107-1-AP) by Proteintech is a Polyclonal antibody targeting C5orf51 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse samples
30107-1-AP targets C5orf51 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples.
Tested Applications
Positive WB detected in: HeLa cells, HEK-293T cells, HepG2 cells
Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Specification
Tested Reactivity: Human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag32440 Product name: Recombinant human C5orf51 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-293 aa of XM_011514032 Sequence: FSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN Predict reactive species
Full Name: chromosome 5 open reading frame 51
Calculated Molecular Weight: 34kd
Observed Molecular Weight: 34-40 kDa
GenBank Accession Number: XM_011514032
Gene Symbol: C5orf51
Gene ID (NCBI): 285636
RRID: AB_3086230
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: A6NDU8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924