Iright
BRAND / VENDOR: Proteintech

Proteintech, 30108-1-AP, DDAH1 Polyclonal antibody

CATALOG NUMBER: 30108-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DDAH1 (30108-1-AP) by Proteintech is a Polyclonal antibody targeting DDAH1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 30108-1-AP targets DDAH1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Caco-2 cells, SH-SY5Y cells, mouse brain tissue Positive IHC detected in: mouse brain tissue, human stomach cancer tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Dimethylarginine dimethylaminohydrolase 1 (DDAH1) is an enzyme that can degrade asymmetric dimethylarginine (ADMA), an endogenous nitric oxide synthase (NOS)inhibitor (PMID:26996393). About 80% of endogenous ADMA is metabolized by DDAH, principally the DDAH1 isoform (PMID:22460174). It was reported that DDAH1 is highly expressed in vascular endothelial cells in hearts (PMID:19917889). The observed molecular weight of DDAH1 is 35-40 kDa in the literature. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32516 Product name: Recombinant human DDAH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 168-285 aa of NM_012137 Sequence: VADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS Predict reactive species Full Name: dimethylarginine dimethylaminohydrolase 1 Calculated Molecular Weight: 31kd Observed Molecular Weight: 35 kDa GenBank Accession Number: NM_012137 Gene Symbol: DDAH1 Gene ID (NCBI): 23576 RRID: AB_2935515 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94760 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924