Proteintech, 30109-1-AP, NLRP3 Polyclonal antibody

Size: 20ul / 150ul The NLRP3 (30109-1-AP) by Proteintech is a Polyclonal antibody targeting NLRP3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 30109-1-AP targets NLRP3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LPS treated RAW 264.7 cells, J774A.1 cells, rat spleen tissue, LPS and Brefeldin A treated NR8383 cells, RAW 264.7 cells Positive IP detected in: RAW 264.7 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NLRP3, also named as NALP3, CIASI, C1orf7, PYPAF1, Cryopyrin and MIM606416, belongs to NLR family. NLRP3, a key and eponymous component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. NLRP3 inflammasome is expressed in immune cells, including monocytes, macrophages, and dendritic cells. When the NLRP3 inflammasome is activated, the PYD domain of NLRP3 mediates recruitment of an adaptor protein called ASC and the effector protein procaspase-1 to form an NLRP3 inflammasome complex that can cleave inactive procaspase-1 to from active caspase-1. And then the active caspase-1 results in secretion of interleukin (IL)-18 and IL-1β. Activation of the NLRP3 inflammasome is also required for HMGB1 secretion. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death (PMID:27669650). NLRP3 has some isoforms with the MW of 106-118 kDa and 75-83 kDa. An additional 130-135 kDa band could also be detected (PMID: 17164409; PMID: 34680443; PMID: 35585627). This antibody is specific for mouse NLRP3. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, chicken, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32515 Product name: Recombinant mouse NLRP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-153 aa of NM_145827 Sequence: MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR Predict reactive species Full Name: NLR family, pyrin domain containing 3 Calculated Molecular Weight: 118kd Observed Molecular Weight: 108-120 kDa GenBank Accession Number: NM_145827 Gene Symbol: Nlrp3 Gene ID (NCBI): 216799 RRID: AB_3086231 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8R4B8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.