Proteintech, 30112-1-AP, TTC21B Polyclonal antibody

Size: 20ul / 150ul The TTC21B (30112-1-AP) by Proteintech is a Polyclonal antibody targeting TTC21B in WB, IHC, ELISA applications with reactivity to Human, mouse samples 30112-1-AP targets TTC21B in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, K-562 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information TTC21B, also known as THM1, IFT139, belongs to the TTC21 family, containing several tetratricopeptide repeat (TPR) domains. TTC21B is a component of the IFT complex A (IFT-A), a complex required for retrograde ciliary transport and entry into cilia of G protein-coupled receptors (GPCRs). TTC21B is essential for retrograde trafficking of IFT-1, IFT-B, and GPCRs (PubMed:27932497). TTC21B is localized to the cilium axoneme and may play a role in retrograde intraflagellar transport in cilia (PMID: 18327258). Mutations in TTC21B are associated with nephronophthisis 12 (NPHP12)and short-rib thoracic dysplasia 4 with or without polydactyly (SRTD4)(PMID: 21258341). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32456 Product name: Recombinant human TTC21B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 149-462 aa of NM_024753 Sequence: AWLDITRGKEPYTKKALKYFEEGLQDGNDTFALLGKAQCLEMRQNYSGALETVNQIIVNFPSFLPAFVKKMKLQLALQDWDQTVETAQRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNTLDAMEPQNAQLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELGYQMILQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLNDVLDTHFSQLEGLPLGIQYFEKLNPDFLLEIVMEYLSFCPMQ* Predict reactive species Full Name: tetratricopeptide repeat domain 21B Calculated Molecular Weight: 151KD Observed Molecular Weight: 55 kDa GenBank Accession Number: NM_024753 Gene Symbol: TTC21B Gene ID (NCBI): 79809 RRID: AB_3086232 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z4L5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.