Proteintech, 30117-1-AP, TGFBR1 Polyclonal antibody

Size: 20ul / 150ul The TGFBR1 (30117-1-AP) by Proteintech is a Polyclonal antibody targeting TGFBR1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 30117-1-AP targets TGFBR1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, MDA-MB-231 cells, NCI-H1299 cells, U-87 MG cells, mouse liver tissue, rat liver tissue Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse ovary tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information TGFBR1 (TGF-beta receptor type-1) encodes a serine/threonine kinase receptor for transforming growth factor-beta. TGFB1, TGFB2 and TGFB3 signals are transduced from the cell surface to the cytoplasm and regulate lots of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Mutations in both TGFBR2 and TGFBR1 were associated with early onset and aggressive thoracic aortic disease with MFS-like skeletal features, but also hypertelorism, craniosynostosis, developmental delay, cleft palate and bifid uvula, congenital heart disease and aneurysms, and dissections throughout the arterial tree with marked arterial tortuosity (PMID: 15731757, PMID: 27879313). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31620 Product name: Recombinant human TGFBR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-180 aa of NM_004612 Sequence: LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL Predict reactive species Full Name: transforming growth factor, beta receptor 1 Calculated Molecular Weight: 56KD Observed Molecular Weight: 56 kDa GenBank Accession Number: NM_004612 Gene Symbol: TGFBR1 Gene ID (NCBI): 7046 RRID: AB_3086235 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36897 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.