Proteintech, 30127-1-AP, PARP14 Polyclonal antibody

Size: 20ul / 150ul The PARP14 (30127-1-AP) by Proteintech is a Polyclonal antibody targeting PARP14 in IHC, ELISA applications with reactivity to human samples 30127-1-AP targets PARP14 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PARP14 (poly (ADP-ribose) polymerase family, member 14) is a PARP family member that has roles in DNA repair, B cell regulation, and focal adhesion (PMID: 25753673). The largest of all the human PARPs is PARP14. PARP14 has been reported to regulate several different pathways involved in immunity, inflammation, and genome stability (PMID: 37703374). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32409 Product name: Recombinant human PARP14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1501-1640 aa of NM_017554 Sequence: SRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTC Predict reactive species Full Name: poly (ADP-ribose) polymerase family, member 14 Calculated Molecular Weight: 203kd GenBank Accession Number: NM_017554 Gene Symbol: PARP14 Gene ID (NCBI): 54625 RRID: AB_3086239 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q460N5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.