Proteintech, 30132-1-AP, C4orf26 Polyclonal antibody

Size: 20ul / 150ul The C4orf26 (30132-1-AP) by Proteintech is a Polyclonal antibody targeting C4orf26 in IHC, ELISA applications with reactivity to human samples 30132-1-AP targets C4orf26 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Chromosome 4 open reading frame 26 (C4orf26), also known as odontogenesis associated phosphoprotein (ODAPH), is an enamel matrix protein at the maturation stage. It has been reported that mutations in C4orf26 gene are associated with autosomal recessive type of Amelogenesis Imperfecta (AI), a hereditary condition that affects enamel formation/mineralization (PMID: 33884476; PMID: 36163390). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32600 Product name: Recombinant human C4orf26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-130 aa of NM_001206981 Sequence: QEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRCPFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES Predict reactive species Full Name: chromosome 4 open reading frame 26 Calculated Molecular Weight: 16kd GenBank Accession Number: NM_001206981 Gene Symbol: C4orf26 Gene ID (NCBI): 152816 RRID: AB_3086240 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q17RF5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.