Proteintech, 30134-1-AP, FILIP1L Polyclonal antibody

Size: 20ul / 150ul The FILIP1L (30134-1-AP) by Proteintech is a Polyclonal antibody targeting FILIP1L in WB, IHC, ELISA applications with reactivity to Human, mouse samples 30134-1-AP targets FILIP1L in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, mouse colon tissue Positive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32655 Product name: Recombinant human FILIP1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 566-661 aa of BC027860 Sequence: DNEPPDYKSLIPLERAVINGQLYEESENQDEDPNDEGSVLSFKCSQSTPCPVNRKLWIPWMKSKEGHLQNGKMQTKPNANFVQPGDLVLSHTPGQP Predict reactive species Full Name: filamin A interacting protein 1-like Calculated Molecular Weight: 893 aa, 102 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC027860 Gene Symbol: FILIP1L Gene ID (NCBI): 11259 RRID: AB_3086241 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q4L180 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.