Proteintech, 30152-1-AP, ISM1 Polyclonal antibody

Size: 20ul / 150ul The ISM1 (30152-1-AP) by Proteintech is a Polyclonal antibody targeting ISM1 in WB, ELISA applications with reactivity to Human samples 30152-1-AP targets ISM1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HT-29 cells, TT cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information ISM1, also known as C20orf82. It is expected to be located in extracellular space, and the protein is enriched in the thyroid gland tissue. Acts as an angiogenesis inhibitor. The protein is predicted to be involved in negative regulation of angiogenesis. Since the molecular weight of the detected ISM1 was larger than expected (52 kD), ISM1 is likely subject to posttranslational modifications. Glycosylation is commonly found in many secreted proteins, and analysis of the ISM1 protein sequence predicted two putative N-glycosylation sites at positions N39 and N282. (PMID: 31171630) Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32761 Product name: Recombinant human ISM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-228 aa of NM_080826 Sequence: ADGPDAAAGNASQAQLQNNLNVGSDTTSETSFSLSKEAPREHLDHQAAHQPFPRPRFRQETGHPSLQRDFPRSFLLDLPNFPDLSKADINGQNPNIQVTIEVVDGPDSEADKDQHPENKPSWSVPSPDWRAWWQRSLSLARANSGDQDYKYDSTSDDSNFLNPPRGWDHTAPGHRTFETKDQPEYDSTDGEGDWSLWSV Predict reactive species Full Name: isthmin 1 homolog (zebrafish) Calculated Molecular Weight: 52kd Observed Molecular Weight: 52 kDa, 70 kDa GenBank Accession Number: NM_080826 Gene Symbol: ISM1 Gene ID (NCBI): 140862 RRID: AB_3669703 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: B1AKI9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.