Product Description
Size: 20ul / 150ul
The FBXO44 (30162-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO44 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples
30162-1-AP targets FBXO44 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue
Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
FBXO44 is a member of the F-box protein family that shares a function as substrate recognition factors for the SKP1-CUL1-F-box (SCF)-type ubiquitin ligase. Several human FBXs (FBXO2, FBXO6, FBXO17, FBXO27, and FBXO44) share a conserved G domain (also known as FBA domain), which is responsible for recognizing N-glycan moieties by most FBXs in this group except FBXO44. (PMID: 25970626, PMID: 23086937)
Specification
Tested Reactivity: Human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag32432 Product name: Recombinant human FBXO44 protein Source: e coli. -derived, PKG Tag: GST Domain: 82-122 aa of BC007832 Sequence: LHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQV Predict reactive species
Full Name: F-box protein 44
Calculated Molecular Weight: 26 kDa
Observed Molecular Weight: 35 kDa
GenBank Accession Number: BC007832
Gene Symbol: FBXO44
Gene ID (NCBI): 93611
RRID: AB_3086253
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9H4M3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924