Iright
BRAND / VENDOR: Proteintech

Proteintech, 30171-1-AP, ADCY8 Polyclonal antibody

CATALOG NUMBER: 30171-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ADCY8 (30171-1-AP) by Proteintech is a Polyclonal antibody targeting ADCY8 in WB, ELISA applications with reactivity to Human samples 30171-1-AP targets ADCY8 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ADCY8 Belongs to the adenylyl cyclase class-4/guanylyl cyclase family. is a membrane-bound, calcium-stimulable adenylyl cyclase. May be involved in learning, in memory and in drug dependence. The antibody is specific to ADCY8. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32901 Product name: Recombinant human ADCY8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 561-715 aa of NM_001115 Sequence: GDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPEDIVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSN Predict reactive species Full Name: adenylate cyclase 8 (brain) Calculated Molecular Weight: 140kd Observed Molecular Weight: 140-150 kDa GenBank Accession Number: NM_001115 Gene Symbol: ADCY8 Gene ID (NCBI): 114 RRID: AB_2935523 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40145 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924