Proteintech, 30197-1-AP, SMPD1,ASM Polyclonal antibody

Size: 20ul / 150ul The SMPD1,ASM (30197-1-AP) by Proteintech is a Polyclonal antibody targeting SMPD1,ASM in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 30197-1-AP targets SMPD1,ASM in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human placenta tissue Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SMPD1(Sphingomyelin phosphodiesterase) is also named as ASM and belongs to the acid sphingomyelinase family. It is an important enzyme in sphingolipid metabolism and plays key roles in apoptosis, immunity, development, and cancer. The deficient activity of this enzyme results in Types A and B Niemann-Pick disease (NPD). This protein has 4 isoforms produced by alternative splicing. SMPD1 can produce a 60 kDa peptide with its signal peptide missing. As a catalytically inactive 75kDa precursor, after signal peptide cleavage, it was processed into smaller non-glycosylated and rapidly degraded 57kDa form in ER-Golgi complex. And 70kDa mature form with major catalytic activity located in lysosomes, which is further processed into 52kDa form (PMID:25853898, PMID:26499107). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32479 Product name: Recombinant human SMPD1,ASM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 48-230 aa of BC041164 Sequence: SDSRVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRG Predict reactive species Full Name: sphingomyelin phosphodiesterase 1, acid lysosomal Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 68-70 kDa GenBank Accession Number: BC041164 Gene Symbol: SMPD1 Gene ID (NCBI): 6609 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17405 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.