Proteintech, 30205-1-AP, E-selectin / CD62E Polyclonal antibody

Size: 20ul / 150ul The E-selectin / CD62E (30205-1-AP) by Proteintech is a Polyclonal antibody targeting E-selectin / CD62E in IHC, IF-P, ELISA applications with reactivity to Human samples 30205-1-AP targets E-selectin / CD62E in IHC, IF-P, ELISA applications and shows reactivity with Human samples. Tested Applications Positive IHC detected in: human appendicitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human appendicitis tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information E-selectin, also known as ELAM-1 or CD62E, is a member of the selectin family of adhesion molecules that also includes L-selectin and P-selectin. E-selectin is an inducible endothelial cell surface molecule. Its expression on endothelial cells is transcriptionally upregulated by various proinflammatory substances such as IL-1, TNFα and lipopolysaccharide (LPS). Besides, it can be secreted by endothelial cells, and can be detected in a soluble form (sE-selectin) in serum. During inflammation, E-selectin plays an important part in recruiting leukocytes to the site of injury. (PMID: 2827173; 1382417; 8943958) Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31820 Product name: Recombinant human SELE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 164-371 aa of BC142711 Sequence: KCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALS Predict reactive species Full Name: selectin E Calculated Molecular Weight: 610 aa, 67 kDa GenBank Accession Number: BC142711 Gene Symbol: CD62E Gene ID (NCBI): 6401 RRID: AB_2935530 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16581 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.