Proteintech, 30211-1-AP, SLC7A8 Polyclonal antibody

Size: 20ul / 150ul The SLC7A8 (30211-1-AP) by Proteintech is a Polyclonal antibody targeting SLC7A8 in WB, IF/ICC, ELISA applications with reactivity to human samples 30211-1-AP targets SLC7A8 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue, JAR cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Solute carrier family 7 member 8 (SLC7A8), also known as LAT2, is an amino acid transporter that, together with LAT1 (SLC7A5), facilitates the bidirectional transport of branched-chain and aromatic AAs across the plasma membrane. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32957 Product name: Recombinant human SLC7A8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 468-535 aa of Sequence: YWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP Predict reactive species Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 8 Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 45-50 kDa Gene Symbol: SLC7A8 Gene ID (NCBI): 23428 RRID: AB_3086264 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHI5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.